PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 317859
Common NameARALYDRAFT_317859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 165aa    MW: 18923.6 Da    PI: 9.2108
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
317859genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-1587131347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++d+ +++G+g W+ I+r++ k+Rt  q+ s+ qky
           317859  87 PWTEEEHRLFLDGLNKYGKGAWSMISREFVKTRTKIQVASHAQKY 131
                      7*******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071784354IPR001005SANT/Myb domain
SuperFamilySSF466897.9E-5656IPR009057Homeodomain-like
SuperFamilySSF466894.83E-1680136IPR009057Homeodomain-like
PROSITE profilePS5129417.43980136IPR017930Myb domain
TIGRFAMsTIGR015571.1E-1483134IPR006447Myb domain, plants
SMARTSM007172.2E-1084134IPR001005SANT/Myb domain
PfamPF002494.2E-1187131IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-1187131IPR009057Homeodomain-like
CDDcd001679.88E-1087131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MAWIPPWTRD DDKRFELALV IFPEGSPSFL ENIAQLLQKP LGLVKYHYDA LVYDVALVES  60
GKYALPKYPD DDNVSLTEAT QSKHGIPWTE EEHRLFLDGL NKYGKGAWSM ISREFVKTRT  120
KIQVASHAQK YDKRQKLDIN KRKRRSIHDI TSESTMGKPD NFGV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0115603e-69AC011560.6 Arabidopsis thaliana chromosome 3 BAC F13M14 genomic sequence, complete sequence.
GenBankATAC0134283e-69AC013428.6 Arabidopsis thaliana chromosome III BAC F18K10 genomic sequence, complete sequence.
GenBankCP0026863e-69CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884800.11e-120hypothetical protein ARALYDRAFT_317859
TrEMBLD7L9121e-120D7L912_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_30008751e-120(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14731719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.19e-67MYB_related family protein